PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_017666-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB
Protein Properties Length: 302aa    MW: 34337.7 Da    PI: 7.6426
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_017666-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.13.6e-171562148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEd++l ++v q+G g+W+t++ + g+ R +k+c++rw +yl
    NNU_017666-RA 15 KGLWSPEEDQRLRNYVLQHGHGCWSTVPIKAGLQRNGKSCRLRWINYL 62
                     678*******************************************97 PP

2Myb_DNA-binding50.35.7e-1669113248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      g +T +E+e ++ ++++lG++ W+ Ia++++ gRt++++k++w++yl
    NNU_017666-RA  69 GVFTIQEEETILSLHRLLGNK-WSQIAQHLP-GRTDNEIKNFWNSYL 113
                      78999****************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.0031066IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-211065IPR009057Homeodomain-like
SuperFamilySSF466898.07E-2912109IPR009057Homeodomain-like
SMARTSM007173.7E-111464IPR001005SANT/Myb domain
PfamPF002491.9E-141562IPR001005SANT/Myb domain
CDDcd001675.01E-101862No hitNo description
Gene3DG3DSA:1.10.10.604.5E-2566117IPR009057Homeodomain-like
SMARTSM007176.8E-1467115IPR001005SANT/Myb domain
PROSITE profilePS5129420.72367117IPR017930Myb domain
PfamPF002496.6E-1569113IPR001005SANT/Myb domain
CDDcd001671.13E-1071113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MGCKSCDKPK PKHRKGLWSP EEDQRLRNYV LQHGHGCWST VPIKAGLQRN GKSCRLRWIN  60
YLRPGLKHGV FTIQEEETIL SLHRLLGNKW SQIAQHLPGR TDNEIKNFWN SYLKKKVMKV  120
EALELAQINS QLLNSAPKTE EYSMQTINPN TQQVSSFQSF QQMEDSAVDA DRSVPLPHAP  180
DDKVALQSSL PRLLFAEWLS SDHINNRNFV NSGGTMAISS MMSDNSNPDY AFKHNLLRDD  240
GQFGNEFRSG LSNGAATYNQ KFPIQLEQEI NHQIPAVGNG VFDFVSMSDI CNDFNMTHDV  300
IY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-24151177108B-MYB
1h8a_C6e-241111723128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010273109.10.0PREDICTED: transcription factor LAF1-like
SwissprotQ9M0K42e-62LAF1_ARATH; Transcription factor LAF1
TrEMBLA0A061G1E11e-101A0A061G1E1_THECC; Myb domain protein 18, putative
STRINGVIT_16s0050g00050.t013e-99(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52260.16e-62myb domain protein 19